Lineage for d3l7zd2 (3l7z D:188-271)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573956Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2573957Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2574109Family d.101.1.0: automated matches [227218] (1 protein)
    not a true family
  6. 2574110Protein automated matches [226956] (5 species)
    not a true protein
  7. 2574136Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)
  8. 2574162Domain d3l7zd2: 3l7z D:188-271 [232817]
    Other proteins in same PDB: d3l7za1, d3l7zc1, d3l7zc2, d3l7zc3, d3l7zd1, d3l7zg1, d3l7zi1, d3l7zi2, d3l7zi3
    automated match to d2je6a2
    protein/RNA complex; complexed with so4

Details for d3l7zd2

PDB Entry: 3l7z (more details), 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome
PDB Compounds: (D:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3l7zd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7zd2 d.101.1.0 (D:188-271) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

SCOPe Domain Coordinates for d3l7zd2:

Click to download the PDB-style file with coordinates for d3l7zd2.
(The format of our PDB-style files is described here.)

Timeline for d3l7zd2: