Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
Protein automated matches [226956] (5 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries) |
Domain d3l7zd2: 3l7z D:188-271 [232817] Other proteins in same PDB: d3l7za1, d3l7zc1, d3l7zc2, d3l7zc3, d3l7zd1, d3l7zg1, d3l7zi1, d3l7zi2, d3l7zi3 automated match to d2je6a2 protein/RNA complex; complexed with so4 |
PDB Entry: 3l7z (more details), 2.41 Å
SCOPe Domain Sequences for d3l7zd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l7zd2 d.101.1.0 (D:188-271) automated matches {Sulfolobus solfataricus [TaxId: 2287]} plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi dqaentarstavklleelkkhlgi
Timeline for d3l7zd2: