SCOPe 2.08: Domain d3l7zd2: 3l7z D:188-271

Lineage for d3l7zd2 (3l7z D:188-271)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)

8. Domain d3l7zd2: 3l7z D:188-271 [232817]
   Other proteins in same PDB: d3l7za1, d3l7zc1, d3l7zc2, d3l7zc3, d3l7zd1, d3l7zg1, d3l7zi1, d3l7zi2, d3l7zi3
   automated match to d2je6a2
   protein/RNA complex; complexed with so4

Details for d3l7zd2

PDB Entry: 3l7z, 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome

PDB Compounds: (D:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3l7zd2:

Sequence; same for both SEQRES and ATOM records:

>d3l7zd2 d.101.1.0 (D:188-271) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

Timeline for d3l7zd2:

• d3l7zd2 first appeared in SCOPe 2.03
  
• d3l7zd2 appears in SCOPe 2.07