SCOPe 2.03: Domain d3l70d2: 3l70 D:196-241

Lineage for d3l70d2 (3l70 D:196-241)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family
6. Protein automated matches [232791] (1 species)
   not a true protein
7. Species Gallus gallus [TaxId:9031] [232792] (1 PDB entry)

8. Domain d3l70d2: 3l70 D:196-241 [232810]
   Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
   automated match to d1ppjd2
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70d2

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l70d2:

Sequence; same for both SEQRES and ATOM records:

>d3l70d2 f.23.11.0 (D:196-241) automated matches {Gallus gallus [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

Timeline for d3l70d2:

• d3l70d2 is new in SCOPe 2.03-stable
  
• d3l70d2 appears in SCOPe 2.04
  
• d3l70d2 appears in the current release, SCOPe 2.08