SCOP 1.59: Domain d1stma_: 1stm A:

Lineage for d1stma_ (1stm A:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (15 proteins)

6. Protein SPMV coat protein [49617] (1 species)

7. Species Satellite panicum mosaic virus [TaxId:154834] [49618] (1 PDB entry)

8. Domain d1stma_: 1stm A: [23281]

Details for d1stma_

PDB Entry: 1stm, 1.9 Å

PDB Description: satellite panicum mosaic virus

SCOP Domain Sequences for d1stma_:

Sequence; same for both SEQRES and ATOM records:

>d1stma_ b.10.1.2 (A:) SPMV coat protein {Satellite panicum mosaic virus}
aaatslvydtcyvtlterattsfqrqsfptlkgmgdrafqvvaftiqgvsaaplmynarl
ynpgdtdsvhatgvqlmgtvprtvrltprvgqnnwffgnteeaetilaidglvstkgana
psntvivtgcfrlapselqss

Timeline for d1stma_:

• d1stma_ first appeared (with stable ids) in SCOP 1.55
  
• d1stma_ appears in SCOP 1.57
  
• d1stma_ appears in SCOP 1.61
  
• d1stma_ appears in the current release, SCOPe 2.08