Lineage for d3l70d1 (3l70 D:1-195)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1477288Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1477327Protein automated matches [232767] (3 species)
    not a true protein
  7. 1477328Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)
  8. 1477335Domain d3l70d1: 3l70 D:1-195 [232807]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
    automated match to d1ppjd1
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70d1

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l70d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

SCOPe Domain Coordinates for d3l70d1:

Click to download the PDB-style file with coordinates for d3l70d1.
(The format of our PDB-style files is described here.)

Timeline for d3l70d1: