Lineage for d3l70a1 (3l70 A:1-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005465Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 3005466Protein automated matches [232766] (2 species)
    not a true protein
  7. 3005467Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 3005468Domain d3l70a1: 3l70 A:1-233 [232805]
    Other proteins in same PDB: d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
    automated match to d1pp9a1
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70a1

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (A:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

SCOPe Domain Sequences for d3l70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70a1 d.185.1.0 (A:1-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
aatyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfve
hlafkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqnc
aleesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltra
dlasyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr

SCOPe Domain Coordinates for d3l70a1:

Click to download the PDB-style file with coordinates for d3l70a1.
(The format of our PDB-style files is described here.)

Timeline for d3l70a1: