| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
| Protein automated matches [232766] (2 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
| Domain d3l71o2: 3l71 O:236-439 [232800] Other proteins in same PDB: d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ automated match to d1ppjb2 complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71o2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71o2 d.185.1.0 (O:236-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel
Timeline for d3l71o2:
View in 3DDomains from other chains: (mouse over for more information) d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ |