Lineage for d1gff2_ (1gff 2:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823004Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. 2823005Family b.121.5.1: Microviridae-like VP [49612] (2 proteins)
  6. Protein Microvirus capsid proteins, spike protein G [418933] (3 species)
    protein includes capsid protein F and spike protein G
  7. Species Bacteriophage G4 [TaxId:10843] [419369] (1 PDB entry)
  8. 2823022Domain d1gff2_: 1gff 2: [23280]
    Other proteins in same PDB: d1gff1_

Details for d1gff2_

PDB Entry: 1gff (more details), 3 Å

PDB Description: the atomic structure of the degraded procapsid particle of the bacteriophage g4: induced structural changes in the presence of calcium ions and functional implications
PDB Compounds: (2:) bacteriophage g4 capsid proteins gpf, gpg, gpj

SCOPe Domain Sequences for d1gff2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gff2_ b.121.5.1 (2:) Microvirus capsid proteins, spike protein G {Bacteriophage G4 [TaxId: 10843]}
mfqkfiskhnapinstqlaatktpavaapvlsvpnlsrstilinatttavtthsglchvv
ridetnptnhhalsiagslsnvpadmiafairfevadgvvptavpalydvypietfnngk
aisfkdavtidshprtvgndvyagimlwsnawtastisgvlsvnqvnreatvlqplk

SCOPe Domain Coordinates for d1gff2_:

Click to download the PDB-style file with coordinates for d1gff2_.
(The format of our PDB-style files is described here.)

Timeline for d1gff2_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gff1_