SCOPe 2.03: Domain d3l70o2: 3l70 O:236-439

Lineage for d3l70o2 (3l70 O:236-439)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (1 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [232768] (2 PDB entries)

8. Domain d3l70o2: 3l70 O:236-439 [232798]
   Other proteins in same PDB: d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70p1, d3l70p2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
   automated match to d1ppjb2
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70o2

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (O:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l70o2:

Sequence; same for both SEQRES and ATOM records:

>d3l70o2 d.185.1.0 (O:236-439) automated matches {Gallus gallus [TaxId: 9031]}
katywggeireqnghslvhaavvtegaavgsaeanafsvlqhvlgagplikrgssvtskl
yqgvakattqpfdasafnvnysdsglfgfytisqaahageviraamnqlkaaaqggvtee
dvtkaknqlkatylmsvetaqgllneigseallsgthtapsvvaqkidsvtsadvvnaak
kfvsgkksmaasgdlgstpfldel

Timeline for d3l70o2:

• d3l70o2 is new in SCOPe 2.03-stable
  
• d3l70o2 appears in SCOPe 2.04
  
• d3l70o2 appears in the current release, SCOPe 2.08