![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.5: ssDNA viruses [88645] (4 families) ![]() |
![]() | Family b.121.5.1: Microviridae-like VP [49612] (2 proteins) |
![]() | Protein Microvirus capsid proteins, capsid protein F [418932] (3 species) protein includes capsid protein F and spike protein G |
![]() | Species Bacteriophage G4 [TaxId:10843] [419368] (1 PDB entry) |
![]() | Domain d1gff1_: 1gff 1: [23279] Other proteins in same PDB: d1gff2_ has additional subdomain(s) that are not in the common domain |
PDB Entry: 1gff (more details), 3 Å
SCOPe Domain Sequences for d1gff1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gff1_ b.121.5.1 (1:) Microvirus capsid proteins, capsid protein F {Bacteriophage G4 [TaxId: 10843]} vphdlshlvfeagkigrlktiswtpvvagdsfecdmvgairlsplrrglavdsrvdifsf yiphrhiygqqwinfmkdgvnasplppvtcssgwdsaaylgtipsstlkvpkflhqgyln iynnyfkppwsddltyanpsnmpsedykwgvrvanlksiwtaplppdtrtsenmttgtst idimglqaayaklhteqerdyfmtryrdimkefgghtsydgdnrplllmrsefwasgydv dgtdqsslgqfsgrvqqtfnhkvprfyvpehgvimtlavtrfppthememhylvgkenlt ytdiacdpalmanlpprevslkeffhsspdsakfkiaegqwyrtqpdrvafpynaldgfp fysalpstdlkdrvlvntnnydeifqsmqlahwnmqtkfninvyrhmpttrdsimts
Timeline for d1gff1_: