SCOPe 2.08: Domain d1gff1_: 1gff 1:

Lineage for d1gff1_ (1gff 1:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (4 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (2 proteins)

6. Protein Microvirus capsid proteins, capsid protein F [418932] (3 species)
   protein includes capsid protein F and spike protein G

7. Species Bacteriophage G4 [TaxId:10843] [419368] (1 PDB entry)

8. Domain d1gff1_: 1gff 1: [23279]
   Other proteins in same PDB: d1gff2_
   has additional subdomain(s) that are not in the common domain

Details for d1gff1_

PDB Entry: 1gff, 3 Å

PDB Description: the atomic structure of the degraded procapsid particle of the bacteriophage g4: induced structural changes in the presence of calcium ions and functional implications

PDB Compounds: (1:) bacteriophage g4 capsid proteins gpf, gpg, gpj

SCOPe Domain Sequences for d1gff1_:

Sequence; same for both SEQRES and ATOM records:

>d1gff1_ b.121.5.1 (1:) Microvirus capsid proteins, capsid protein F {Bacteriophage G4 [TaxId: 10843]}
vphdlshlvfeagkigrlktiswtpvvagdsfecdmvgairlsplrrglavdsrvdifsf
yiphrhiygqqwinfmkdgvnasplppvtcssgwdsaaylgtipsstlkvpkflhqgyln
iynnyfkppwsddltyanpsnmpsedykwgvrvanlksiwtaplppdtrtsenmttgtst
idimglqaayaklhteqerdyfmtryrdimkefgghtsydgdnrplllmrsefwasgydv
dgtdqsslgqfsgrvqqtfnhkvprfyvpehgvimtlavtrfppthememhylvgkenlt
ytdiacdpalmanlpprevslkeffhsspdsakfkiaegqwyrtqpdrvafpynaldgfp
fysalpstdlkdrvlvntnnydeifqsmqlahwnmqtkfninvyrhmpttrdsimts

Timeline for d1gff1_:

• d1gff1_ first appeared (with stable ids) in SCOP 1.55
  
• d1gff1_ appears in SCOPe 2.07