![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein automated matches [232759] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [232779] (1 PDB entry) |
![]() | Domain d3l2oa1: 3l2o A:1002-1068 [232785] automated match to d1fs1b2 |
PDB Entry: 3l2o (more details), 2.8 Å
SCOPe Domain Sequences for d3l2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2oa1 d.42.1.1 (A:1002-1068) automated matches {Human (Homo sapiens) [TaxId: 9606]} asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd d
Timeline for d3l2oa1: