Lineage for d3l2oa1 (3l2o A:1002-1068)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647551Protein automated matches [232759] (2 species)
    not a true protein
  7. 1647552Species Human (Homo sapiens) [TaxId:9606] [232779] (2 PDB entries)
  8. 1647553Domain d3l2oa1: 3l2o A:1002-1068 [232785]
    automated match to d1fs1b2

Details for d3l2oa1

PDB Entry: 3l2o (more details), 2.8 Å

PDB Description: structure-based mechanism of dimerization-dependent ubiquitination by the scffbx4 ubiquitin ligase
PDB Compounds: (A:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d3l2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2oa1 d.42.1.1 (A:1002-1068) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
d

SCOPe Domain Coordinates for d3l2oa1:

Click to download the PDB-style file with coordinates for d3l2oa1.
(The format of our PDB-style files is described here.)

Timeline for d3l2oa1: