![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
![]() | Protein automated matches [232767] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries) |
![]() | Domain d3l71d1: 3l71 D:1-195 [232784] Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ automated match to d1ppjd1 complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms qiakdvctflrwaae
Timeline for d3l71d1: