SCOPe 2.08: Domain d3l4od_: 3l4o D:

Lineage for d3l4od_ (3l4o D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families)

5. Family b.69.2.0: automated matches [232760] (1 protein)
   not a true family

6. Protein automated matches [232762] (1 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)

8. Domain d3l4od_: 3l4o D: [232782]
   Other proteins in same PDB: d3l4oc_, d3l4oe_
   automated match to d2madh_
   complexed with 1pe, act, ca, hec, pg4

Details for d3l4od_

PDB Entry: 3l4o, 2.05 Å

PDB Description: crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide

PDB Compounds: (D:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3l4od_:

Sequence; same for both SEQRES and ATOM records:

>d3l4od_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

Timeline for d3l4od_:

• d3l4od_ first appeared in SCOPe 2.03
  
• d3l4od_ appears in SCOPe 2.07