Lineage for d3l4od_ (3l4o D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808749Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2808785Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2808786Protein automated matches [232762] (1 species)
    not a true protein
  7. 2808787Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2808822Domain d3l4od_: 3l4o D: [232782]
    Other proteins in same PDB: d3l4oc_, d3l4oe_
    automated match to d2madh_
    complexed with 1pe, act, ca, hec, pg4

Details for d3l4od_

PDB Entry: 3l4o (more details), 2.05 Å

PDB Description: crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
PDB Compounds: (D:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3l4od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4od_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

SCOPe Domain Coordinates for d3l4od_:

Click to download the PDB-style file with coordinates for d3l4od_.
(The format of our PDB-style files is described here.)

Timeline for d3l4od_: