SCOPe 2.03: Domain d1kvpa_: 1kvp A:

Lineage for d1kvpa_ (1kvp A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)
   include capsid protein F and spike protein G

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d1kvpa_: 1kvp A: [23278]
   chimera with a fragment 1-71 of vp1 from spiroplasma virus SPV4

Details for d1kvpa_

PDB Entry: 1kvp, 27 Å

PDB Description: structural analysis of the spiroplasma virus, spv4, implications for evolutionary variation to obtain host diversity among the microviridae, electron microscopy, alpha carbons only

PDB Compounds: (A:) spv4 capsid protein vp1

SCOPe Domain Sequences for d1kvpa_:

Sequence; same for both SEQRES and ATOM records:

>d1kvpa_ b.121.5.1 (A:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
rqmttstgmapvttkfrdvpnlsgtplifrdnkgrtiktgqlgigpvdagflvaqntaqa
angeraipsnlwadlsnatsidimglqaayanlhtdqerdyfmqryrdvissfggktsyd
adnrpllvmrsnlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalv
rfpptatkeiqylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegq
wyryapsyvspayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfn
vtvyrnlpttrdsimts

Timeline for d1kvpa_:

• d1kvpa_ first appeared (with stable ids) in SCOP 1.55, called d1kvp__
  
• d1kvpa_ appears in SCOPe 2.02
  
• d1kvpa_ appears in SCOPe 2.04
  
• d1kvpa_ appears in the current release, SCOPe 2.08