Lineage for d1kvp__ (1kvp -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382736Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 383210Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 383211Family b.121.5.1: Microviridae-like VP [49612] (1 protein)
  6. 383212Protein Microvirus capsid proteins [49613] (3 species)
    include capsid protein F and spike protein G
  7. 383221Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)
  8. 383228Domain d1kvp__: 1kvp - [23278]
    chimera with a fragment 1-71 of vp1 from spiroplasma virus SPV4

Details for d1kvp__

PDB Entry: 1kvp (more details)

PDB Description: structural analysis of the spiroplasma virus, spv4, implications for evolutionary variation to obtain host diversity among the microviridae, electron microscopy, alpha carbons only

SCOP Domain Sequences for d1kvp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvp__ b.121.5.1 (-) Microvirus capsid proteins {Bacteriophage phi-X174}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
rqmttstgmapvttkfrdvpnlsgtplifrdnkgrtiktgqlgigpvdagflvaqntaqa
angeraipsnlwadlsnatsidimglqaayanlhtdqerdyfmqryrdvissfggktsyd
adnrpllvmrsnlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalv
rfpptatkeiqylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegq
wyryapsyvspayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfn
vtvyrnlpttrdsimts

SCOP Domain Coordinates for d1kvp__:

Click to download the PDB-style file with coordinates for d1kvp__.
(The format of our PDB-style files is described here.)

Timeline for d1kvp__: