SCOP 1.65: Domain d1kvp__: 1kvp -

Lineage for d1kvp__ (1kvp -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d1kvp__: 1kvp - [23278]
   chimera with a fragment 1-71 of vp1 from spiroplasma virus SPV4

Details for d1kvp__

PDB Entry: 1kvp

PDB Description: structural analysis of the spiroplasma virus, spv4, implications for evolutionary variation to obtain host diversity among the microviridae, electron microscopy, alpha carbons only

SCOP Domain Sequences for d1kvp__:

Sequence; same for both SEQRES and ATOM records:

>d1kvp__ b.121.5.1 (-) Microvirus capsid proteins {Bacteriophage phi-X174}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
rqmttstgmapvttkfrdvpnlsgtplifrdnkgrtiktgqlgigpvdagflvaqntaqa
angeraipsnlwadlsnatsidimglqaayanlhtdqerdyfmqryrdvissfggktsyd
adnrpllvmrsnlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalv
rfpptatkeiqylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegq
wyryapsyvspayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfn
vtvyrnlpttrdsimts

Timeline for d1kvp__:

• d1kvp__ first appeared (with stable ids) in SCOP 1.55
  
• d1kvp__ appears in SCOP 1.63
  
• d1kvp__ appears in SCOP 1.67
  
• d1kvp__ appears in the current release, SCOPe 2.08, called d1kvpa_