Lineage for d1kvp__ (1kvp -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11448Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)
  6. 11449Protein Bacteriophage capsid proteins [49613] (2 species)
  7. 11453Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)
  8. 11460Domain d1kvp__: 1kvp - [23278]

Details for d1kvp__

PDB Entry: 1kvp (more details)

PDB Description: structural analysis of the spiroplasma virus, spv4, implications for evolutionary variation to obtain host diversity among the microviridae, electron microscopy, alpha carbons only

SCOP Domain Sequences for d1kvp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kvp__ b.10.1.1 (-) Bacteriophage capsid proteins {Bacteriophage phi-X174}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetels
rqmttstgmapvttkfrdvpnlsgtplifrdnkgrtiktgqlgigpvdagflvaqntaqa
angeraipsnlwadlsnatsidimglqaayanlhtdqerdyfmqryrdvissfggktsyd
adnrpllvmrsnlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalv
rfpptatkeiqylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegq
wyryapsyvspayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfn
vtvyrnlpttrdsimts

SCOP Domain Coordinates for d1kvp__:

Click to download the PDB-style file with coordinates for d1kvp__.
(The format of our PDB-style files is described here.)

Timeline for d1kvp__: