SCOPe 2.04: Domain d1cd3g_: 1cd3 G:

Lineage for d1cd3g_ (1cd3 G:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.5: ssDNA viruses [88645] (3 families)

5. Family b.121.5.1: Microviridae-like VP [49612] (1 protein)

6. Protein Microvirus capsid proteins [49613] (3 species)
   include capsid protein F and spike protein G

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d1cd3g_: 1cd3 G: [23277]
   Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_

Details for d1cd3g_

PDB Entry: 1cd3, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

PDB Compounds: (G:) protein (spike protein gpg)

SCOPe Domain Sequences for d1cd3g_:

Sequence; same for both SEQRES and ATOM records:

>d1cd3g_ b.121.5.1 (G:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

Timeline for d1cd3g_:

• d1cd3g_ first appeared (with stable ids) in SCOP 1.55
  
• d1cd3g_ appears in SCOPe 2.03
  
• d1cd3g_ appears in SCOPe 2.05
  
• d1cd3g_ appears in the current release, SCOPe 2.08