SCOPe 2.07: Domain d3l70n1: 3l70 N:3-233

Lineage for d3l70n1 (3l70 N:3-233)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)

8. Domain d3l70n1: 3l70 N:3-233 [232769]
   Other proteins in same PDB: d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
   automated match to d1pp9a1
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70n1

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (N:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

SCOPe Domain Sequences for d3l70n1:

Sequence; same for both SEQRES and ATOM records:

>d3l70n1 d.185.1.0 (N:3-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl
afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal
eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl
asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr

Timeline for d3l70n1:

• d3l70n1 first appeared in SCOPe 2.03
  
• d3l70n1 appears in SCOPe 2.06
  
• d3l70n1 appears in the current release, SCOPe 2.08