| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
| Protein automated matches [232766] (1 species) not a true protein |
| Domain d3l70n1: 3l70 N:3-233 [232769] Other proteins in same PDB: d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70p1, d3l70p2, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1pp9a1 |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70n1 d.185.1.0 (N:3-233) automated matches {Gallus gallus [TaxId: 9031]}
tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl
afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal
eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl
asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr
Timeline for d3l70n1: