Lineage for d1cd3f_ (1cd3 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823004Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. 2823005Family b.121.5.1: Microviridae-like VP [49612] (2 proteins)
  6. 2823006Protein Microvirus capsid proteins, capsid protein F [418932] (3 species)
    protein includes capsid protein F and spike protein G
  7. 2823012Species Bacteriophage phi-X174 [TaxId:10847] [419370] (4 PDB entries)
  8. 2823014Domain d1cd3f_: 1cd3 F: [23276]
    Other proteins in same PDB: d1cd31_, d1cd32_, d1cd33_, d1cd34_, d1cd3g_
    has additional subdomain(s) that are not in the common domain

Details for d1cd3f_

PDB Entry: 1cd3 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (F:) protein (capsid protein gpf)

SCOPe Domain Sequences for d1cd3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cd3f_ b.121.5.1 (F:) Microvirus capsid proteins, capsid protein F {Bacteriophage phi-X174 [TaxId: 10847]}
sniqtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglai
dstvdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkip
khlfqgylniynnyfkapwmpdrteanpnelnqddarfgfrcchlkniwtaplppetels
rqmttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrs
nlwasgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiq
ylnakgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvsp
ayhllegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttr
dsimts

SCOPe Domain Coordinates for d1cd3f_:

Click to download the PDB-style file with coordinates for d1cd3f_.
(The format of our PDB-style files is described here.)

Timeline for d1cd3f_: