Lineage for d3l2ed1 (3l2e D:2-113)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719300Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2719301Protein automated matches [226884] (9 species)
    not a true protein
  7. 2719327Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries)
  8. 2719335Domain d3l2ed1: 3l2e D:2-113 [232757]
    Other proteins in same PDB: d3l2ea2, d3l2eb2, d3l2ec2, d3l2ed2
    automated match to d3l2fb1

Details for d3l2ed1

PDB Entry: 3l2e (more details), 2.6 Å

PDB Description: Glycocyamine kinase, alpha-beta heterodimer from marine worm Namalycastis sp.
PDB Compounds: (D:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2ed1 a.83.1.0 (D:2-113) automated matches {Namalycastis sp. [TaxId: 243920]}
gsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpng
vtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkp

SCOPe Domain Coordinates for d3l2ed1:

Click to download the PDB-style file with coordinates for d3l2ed1.
(The format of our PDB-style files is described here.)

Timeline for d3l2ed1: