SCOPe 2.07: Domain d3l2eb1: 3l2e B:2-113

Lineage for d3l2eb1 (3l2e B:2-113)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (7 species)
   not a true protein

7. Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries)

8. Domain d3l2eb1: 3l2e B:2-113 [232756]
   Other proteins in same PDB: d3l2ea2, d3l2eb2, d3l2ec2, d3l2ed2
   automated match to d3l2fb1

Details for d3l2eb1

PDB Entry: 3l2e, 2.6 Å

PDB Description: Glycocyamine kinase, alpha-beta heterodimer from marine worm Namalycastis sp.

PDB Compounds: (B:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2eb1:

Sequence; same for both SEQRES and ATOM records:

>d3l2eb1 a.83.1.0 (B:2-113) automated matches {Namalycastis sp. [TaxId: 243920]}
gsaiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpng
vtfdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkp

Timeline for d3l2eb1:

• d3l2eb1 first appeared in SCOPe 2.03
  
• d3l2eb1 appears in SCOPe 2.06