| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein automated matches [227006] (3 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:4932] [232312] (4 PDB entries) |
| Domain d3l10a1: 3l10 A:1-126 [232750] automated match to d1plqa1 |
PDB Entry: 3l10 (more details), 2.8 Å
SCOPe Domain Sequences for d3l10a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l10a1 d.131.1.2 (A:1-126) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl
Timeline for d3l10a1: