Lineage for d1al0g_ (1al0 G:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein) Protein Bacteriophage capsid proteins [49613] (2 species) Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries) 
Domain d1al0g_: 1al0 G: [23275]
Other proteins in same PDB: d1al01_, d1al02_, d1al03_, d1al04_
Details for d1al0g_
PDB Entry: 1al0 (more details), 3.5 Å
PDB Description: procapsid of bacteriophage phix174
SCOP Domain Sequences for d1al0g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1al0g_ b.10.1.1 (G:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
SCOP Domain Coordinates for d1al0g_:
Click to download the PDB-style file with coordinates for d1al0g_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1al0g_:
- d1al0g_ appears in SCOP 1.57
- d1al0g_ appears in the current release, SCOPe 2.08
View in 3D
