Lineage for d1al0g_ (1al0 G:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. Family b.121.5.1: Microviridae-like VP [49612] (2 proteins)
  6. Protein Microvirus capsid proteins, spike protein G [418933] (3 species)
    protein includes capsid protein F and spike protein G
  7. Species Bacteriophage phi-X174 [TaxId:10847] [419371] (3 PDB entries)
  8. Domain d1al0g_: 1al0 G: [23275]
    Other proteins in same PDB: d1al01_, d1al02_, d1al03_, d1al04_, d1al0f_

Details for d1al0g_

PDB Entry: 1al0 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (G:) spike protein gpg

SCOPe Domain Sequences for d1al0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al0g_ b.121.5.1 (G:) Microvirus capsid proteins, spike protein G {Bacteriophage phi-X174 [TaxId: 10847]}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

SCOPe Domain Coordinates for d1al0g_ are not available.

Timeline for d1al0g_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1al01_, d1al02_, d1al03_, d1al04_, d1al0f_