SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3kzva_ (3kzv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2094491Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (4 PDB entries)
  8. 2094492Domain d3kzva_: 3kzv A: [232747]
    automated match to d3u5td_
    complexed with gol

Details for d3kzva_

PDB Entry: 3kzv (more details), 2 Å

PDB Description: The crystal structure of a cytoplasmic protein with unknown function from Saccharomyces cerevisiae
PDB Compounds: (A:) Uncharacterized oxidoreductase YIR035C

SCOPe Domain Sequences for d3kzva_:

Sequence, based on SEQRES records: (download)

>d3kzva_ c.2.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gkvilvtgvsrgigksivdvlfsldkdtvvygvarseaplkklkekygdrffyvvgdite
dsvlkqlvnaavkghgkidslvanagvlepvqnvneidvnawkklydinffsivslvgia
lpelkktngnvvfvssdacnmyfsswgaygsskaalnhfamtlaneerqvkaiavapgiv
dtdmqvnirenvgpssmsaeqlkmfrglkennqlldssvpatvyaklalhgipdgvngqy
lsyndpaladfmp

Sequence, based on observed residues (ATOM records): (download)

>d3kzva_ c.2.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gkvilvtgvsrgigksivdvlfsldkdtvvygvarseaplkklkekygdrffyvvgdite
dsvlkqlvnaavkghgkidslvanagvlepvqnvneidvnawkklydinffsivslvgia
lpelkktngnvvfvssdacnmyfsswgaygsskaalnhfamtlaneerqvkaiavapgiv
dtdmqvnirenvgpssmsaeqlkmfrglkennssvpatvyaklalhgipdgvngqylsyn
dpaladfmp

SCOPe Domain Coordinates for d3kzva_:

Click to download the PDB-style file with coordinates for d3kzva_.
(The format of our PDB-style files is described here.)

Timeline for d3kzva_: