Lineage for d3kzoa2 (3kzo A:165-334)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907308Species Xanthomonas campestris [TaxId:190485] [232743] (6 PDB entries)
  8. 2907310Domain d3kzoa2: 3kzo A:165-334 [232745]
    automated match to d2w37a2
    complexed with an0, cp, gol, so4

Details for d3kzoa2

PDB Entry: 3kzo (more details), 1.9 Å

PDB Description: Crystal structure of N-acetyl-L-ornithine transcarbamylase complexed with carbamyl phosphate and N-acetyl-L-norvaline
PDB Compounds: (A:) N-acetylornithine carbamoyltransferase

SCOPe Domain Sequences for d3kzoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kzoa2 c.78.1.0 (A:165-334) automated matches {Xanthomonas campestris [TaxId: 190485]}
tpdlrgkkyvltwtyhpkplntavansaltiatrmgmdvtllcptpdyilderymdwaaq
nvaesggslqvshdidsayagadvvyakswgalpffgnwepekpirdqyqhfivderkma
ltnngvfshclplrrnvkatdavmdspnciaideaenrlhvqkaimaalv

SCOPe Domain Coordinates for d3kzoa2:

Click to download the PDB-style file with coordinates for d3kzoa2.
(The format of our PDB-style files is described here.)

Timeline for d3kzoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kzoa1