SCOPe 2.03: Domain d3kz1a2: 3kz1 A:942-1082

Lineage for d3kz1a2 (3kz1 A:942-1082)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [117254] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117255] (3 PDB entries)
   Uniprot O15085 714-1081

8. Domain d3kz1a2: 3kz1 A:942-1082 [232741]
   Other proteins in same PDB: d3kz1a1, d3kz1b1, d3kz1e_, d3kz1f_
   automated match to d1xcga2
   complexed with gsp, mg

Details for d3kz1a2

PDB Entry: 3kz1, 2.7 Å

PDB Description: Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated RhoA

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d3kz1a2:

Sequence, based on SEQRES records:

>d3kz1a2 b.55.1.1 (A:942-1082) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchsktavgssdskqtfspvlklnavlirsvatdkraffiictsklgppqiyelva
ltssdkntwmelleeavrnat

Sequence, based on observed residues (ATOM records):

>d3kz1a2 b.55.1.1 (A:942-1082) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
atalerasnplaaefksldlttrkmihegpltwriskdktldlhvllledllvllqkqde
klllkchskqtfspvlklnavlirsvatdkraffiictsklgppqiyelvaltssdkntw
melleeavrnat

Timeline for d3kz1a2:

• d3kz1a2 is new in SCOPe 2.03-stable
  
• d3kz1a2 appears in SCOPe 2.04
  
• d3kz1a2 appears in the current release, SCOPe 2.08