SCOPe 2.08: Domain d3kz1b1: 3kz1 B:715-941

Lineage for d3kz1b1 (3kz1 B:715-941)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF [116957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116958] (5 PDB entries)
   Uniprot O15085 714-1081

8. Domain d3kz1b1: 3kz1 B:715-941 [232740]
   Other proteins in same PDB: d3kz1a2, d3kz1b2, d3kz1e_, d3kz1f_
   automated match to d1xcga1
   complexed with gsp, mg

Details for d3kz1b1

PDB Entry: 3kz1, 2.7 Å

PDB Description: Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated RhoA

PDB Compounds: (B:) Rho guanine nucleotide exchange factor 11

SCOPe Domain Sequences for d3kz1b1:

Sequence; same for both SEQRES and ATOM records:

>d3kz1b1 a.87.1.1 (B:715-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
nwqhtvgkdvvagltqreidrqevinelfvteashlrtlrvldlifyqrmkkenlmpree
larlfpnlpelieihnswceamkklreegpiikeisdlmlarfdgpareelqqvaaqfcs
yqsialeliktkqrkesrfqlfmqeaeshpqcrrlqlrdliisemqrltkyplllesiik
hteggtseheklcrardqcreilkyvneavkqtenrhrlegyqkrld

Timeline for d3kz1b1:

• d3kz1b1 first appeared in SCOPe 2.03
  
• d3kz1b1 appears in SCOPe 2.07