Class b: All beta proteins [48724] (174 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (3 families) |
Family b.121.5.1: Microviridae-like VP [49612] (1 protein) |
Protein Microvirus capsid proteins [49613] (3 species) include capsid protein F and spike protein G |
Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries) |
Domain d1al0f_: 1al0 F: [23274] Other proteins in same PDB: d1al01_, d1al02_, d1al03_, d1al04_ |
PDB Entry: 1al0 (more details), 3.5 Å
SCOPe Domain Sequences for d1al0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1al0f_ b.121.5.1 (F:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]} qtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglaidst vdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkipkhl fqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetelsrqm ttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrsnlw asgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiqyln akgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvspayh llegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttrd
Timeline for d1al0f_: