Lineage for d1al0f_ (1al0 F:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1141359Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1142050Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 1142051Family b.121.5.1: Microviridae-like VP [49612] (1 protein)
  6. 1142052Protein Microvirus capsid proteins [49613] (3 species)
    include capsid protein F and spike protein G
  7. 1142061Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)
  8. 1142064Domain d1al0f_: 1al0 F: [23274]
    Other proteins in same PDB: d1al01_, d1al02_, d1al03_, d1al04_

Details for d1al0f_

PDB Entry: 1al0 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174
PDB Compounds: (F:) capsid protein gpf

SCOPe Domain Sequences for d1al0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al0f_ b.121.5.1 (F:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]}
qtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglaidst
vdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkipkhl
fqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetelsrqm
ttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrsnlw
asgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiqyln
akgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvspayh
llegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttrd

SCOPe Domain Coordinates for d1al0f_:

Click to download the PDB-style file with coordinates for d1al0f_.
(The format of our PDB-style files is described here.)

Timeline for d1al0f_: