SCOP 1.63: Domain d1al0f_: 1al0 F:

Lineage for d1al0f_ (1al0 F:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)

6. Protein Bacteriophage capsid proteins [49613] (3 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d1al0f_: 1al0 F: [23274]
   Other proteins in same PDB: d1al01_, d1al02_, d1al03_, d1al04_

Details for d1al0f_

PDB Entry: 1al0, 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1al0f_:

Sequence; same for both SEQRES and ATOM records:

>d1al0f_ b.10.1.1 (F:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
qtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglaidst
vdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkipkhl
fqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetelsrqm
ttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrsnlw
asgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiqyln
akgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvspayh
llegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttrd

Timeline for d1al0f_:

• d1al0f_ first appeared (with stable ids) in SCOP 1.55
  
• d1al0f_ appears in SCOP 1.61
  
• d1al0f_ appears in SCOP 1.65
  
• d1al0f_ appears in the current release, SCOPe 2.08