Lineage for d1al0f_ (1al0 F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11448Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)
  6. 11449Protein Bacteriophage capsid proteins [49613] (2 species)
  7. 11453Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)
  8. 11456Domain d1al0f_: 1al0 F: [23274]
    Other proteins in same PDB: d1al01_, d1al02_, d1al03_, d1al04_

Details for d1al0f_

PDB Entry: 1al0 (more details), 3.5 Å

PDB Description: procapsid of bacteriophage phix174

SCOP Domain Sequences for d1al0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1al0f_ b.10.1.1 (F:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
qtgaermphdlshlgflagqigrlitisttpviagdsfemdavgalrlsplrrglaidst
vdiftfyvphrhvygeqwikfmkdgvnatplptvnttgyidhaaflgtinpdtnkipkhl
fqgylniynnyfkapwmpdrteanpnelnqddarygfrcchlkniwtaplppetelsrqm
ttsttsidimglqaayanlhtdqerdyfmqryrdvissfggktsydadnrpllvmrsnlw
asgydvdgtdqtslgqfsgrvqqtykhsvprffvpehgtmftlalvrfpptatkeiqyln
akgaltytdiagdpvlygnlppreismkdvfrsgdsskkfkiaegqwyryapsyvspayh
llegfpfiqeppsgdlqervlirhhdydqcfqsvqllqwnsqvkfnvtvyrnlpttrd

SCOP Domain Coordinates for d1al0f_:

Click to download the PDB-style file with coordinates for d1al0f_.
(The format of our PDB-style files is described here.)

Timeline for d1al0f_: