Lineage for d3kwka_ (3kwk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963435Family d.90.1.0: automated matches [191446] (1 protein)
    not a true family
  6. 2963436Protein automated matches [190672] (32 species)
    not a true protein
  7. 2963450Species Bacteroides thetaiotaomicron [TaxId:226186] [232733] (1 PDB entry)
  8. 2963451Domain d3kwka_: 3kwk A: [232734]
    automated match to d4dn2b_
    complexed with cl, fmn, unl

Details for d3kwka_

PDB Entry: 3kwk (more details), 1.54 Å

PDB Description: crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi- 5482 at 1.54 a resolution
PDB Compounds: (A:) Putative NADH dehydrogenase/NAD(P)H nitroreductase

SCOPe Domain Sequences for d3kwka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kwka_ d.90.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
tgnaaldniferksvrtylnkgvekekidlmlragmsapsgkdvrpwefvvvsdraklds
maaalpyakmltqarnaiivcgdsarsfywyldcsaaaqnillaaesmglgavwtaaypy
edrmevvrkythlpenilplcvipfgypatkeqpkqkydekkihynqy

SCOPe Domain Coordinates for d3kwka_:

Click to download the PDB-style file with coordinates for d3kwka_.
(The format of our PDB-style files is described here.)

Timeline for d3kwka_: