![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.5: ssDNA viruses [88645] (3 families) ![]() |
![]() | Family b.121.5.1: Microviridae-like VP [49612] (1 protein) |
![]() | Protein Microvirus capsid proteins [49613] (3 species) include capsid protein F and spike protein G |
![]() | Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries) |
![]() | Domain d2bpa2_: 2bpa 2: [23273] protein/DNA complex |
PDB Entry: 2bpa (more details), 3 Å
SCOPe Domain Sequences for d2bpa2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpa2_ b.121.5.1 (2:) Microvirus capsid proteins {Bacteriophage phi-X174 [TaxId: 10847]} mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
Timeline for d2bpa2_: