Lineage for d2bpa2_ (2bpa 2:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225197Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
    variations: some members have additional 1-2 strands
  4. 225198Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 225199Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)
  6. 225200Protein Bacteriophage capsid proteins [49613] (3 species)
  7. 225207Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)
  8. 225209Domain d2bpa2_: 2bpa 2: [23273]

Details for d2bpa2_

PDB Entry: 2bpa (more details), 3 Å

PDB Description: atomic structure of single-stranded dna bacteriophage phix174 and its functional implications

SCOP Domain Sequences for d2bpa2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpa2_ b.10.1.1 (2:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

SCOP Domain Coordinates for d2bpa2_:

Click to download the PDB-style file with coordinates for d2bpa2_.
(The format of our PDB-style files is described here.)

Timeline for d2bpa2_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bpa1_