![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll variations: some members have additional 1-2 strands |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein) |
![]() | Protein Bacteriophage capsid proteins [49613] (3 species) |
![]() | Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries) |
![]() | Domain d2bpa2_: 2bpa 2: [23273] |
PDB Entry: 2bpa (more details), 3 Å
SCOP Domain Sequences for d2bpa2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpa2_ b.10.1.1 (2:) Bacteriophage capsid proteins {Bacteriophage phi-X174} mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
Timeline for d2bpa2_: