SCOP 1.59: Domain d2bpa2_: 2bpa 2:

Lineage for d2bpa2_ (2bpa 2:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.1: Bacteriophage capsid proteins [49612] (1 protein)

6. Protein Bacteriophage capsid proteins [49613] (2 species)

7. Species Bacteriophage phi-X174 [TaxId:10847] [49614] (4 PDB entries)

8. Domain d2bpa2_: 2bpa 2: [23273]

Details for d2bpa2_

PDB Entry: 2bpa, 3 Å

PDB Description: atomic structure of single-stranded dna bacteriophage phix174 and its functional implications

SCOP Domain Sequences for d2bpa2_:

Sequence; same for both SEQRES and ATOM records:

>d2bpa2_ b.10.1.1 (2:) Bacteriophage capsid proteins {Bacteriophage phi-X174}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk

Timeline for d2bpa2_:

• d2bpa2_ first appeared (with stable ids) in SCOP 1.55
  
• d2bpa2_ appears in SCOP 1.57
  
• d2bpa2_ appears in SCOP 1.61
  
• d2bpa2_ appears in the current release, SCOPe 2.08