Lineage for d2bpa2_ (2bpa 2:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
Superfamily b.121.5: ssDNA viruses [88645] (4 families) 
Family b.121.5.1: Microviridae-like VP [49612] (2 proteins) - Protein Microvirus capsid proteins, spike protein G [418933] (3 species)
protein includes capsid protein F and spike protein G - Species Bacteriophage phi-X174 [TaxId:10847] [419371] (3 PDB entries)
Domain d2bpa2_: 2bpa 2: [23273]
Other proteins in same PDB: d2bpa1_
protein/DNA complex
Details for d2bpa2_
PDB Entry: 2bpa (more details), 3 Å
PDB Description: atomic structure of single-stranded dna bacteriophage phix174 and its functional implications
PDB Compounds: (2:) protein (subunit of bacteriophage phix174)SCOPe Domain Sequences for d2bpa2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpa2_ b.121.5.1 (2:) Microvirus capsid proteins, spike protein G {Bacteriophage phi-X174 [TaxId: 10847]}
mfqtfisrhnsnffsdklvltsvtpassapvlqtpkatsstlyfdsltvnagnggflhci
qmdtsvnaanqvvsvgadiafdadpkffaclvrfesssvpttlptaydvyplngrhdggy
ytvkdcvtidvlprtpgnnvyvgfmvwsnftatkcrglvslnqvikeiiclqplk
SCOPe Domain Coordinates for d2bpa2_:
Click to download the PDB-style file with coordinates for d2bpa2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bpa2_:
- d2bpa2_ first appeared (with stable ids) in SCOP 1.55
- d2bpa2_ appears in SCOPe 2.07
View in 3D
