Lineage for d3knqa1 (3knq A:5-67)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380416Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 2380417Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 2380434Family b.37.1.0: automated matches [191652] (1 protein)
    not a true family
  6. 2380435Protein automated matches [191207] (4 species)
    not a true protein
  7. 2380439Species Enterobacteria phage [TaxId:10864] [232720] (1 PDB entry)
  8. 2380440Domain d3knqa1: 3knq A:5-67 [232722]
    Other proteins in same PDB: d3knqa3, d3knqb2
    automated match to d2g3pa1

Details for d3knqa1

PDB Entry: 3knq (more details), 2.13 Å

PDB Description: beta turn optimization of the gene-3-protein of filamentous phage fd
PDB Compounds: (A:) attachment protein g3p

SCOPe Domain Sequences for d3knqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3knqa1 b.37.1.0 (A:5-67) automated matches {Enterobacteria phage [TaxId: 10864]}
veslakshiegsftnvwkddktldwyanyegilwkatgvvvitgdetqvyaiwvpvglai
pen

SCOPe Domain Coordinates for d3knqa1:

Click to download the PDB-style file with coordinates for d3knqa1.
(The format of our PDB-style files is described here.)

Timeline for d3knqa1: