| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
| Protein automated matches [190646] (49 species) not a true protein |
| Species Mycobacterium smegmatis [TaxId:246196] [232714] (1 PDB entry) |
| Domain d3kkec_: 3kke C: [232717] automated match to d4kmra_ complexed with act |
PDB Entry: 3kke (more details), 2.2 Å
SCOPe Domain Sequences for d3kkec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kkec_ c.93.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
alrhsrsgtiglivpdvnnavfadmfsgvqmaasghstdvllgqidapprgtqqlsrlvs
egrvdgvllqrredfdddmlaavlegvpavtinsrvpgrvgsvilddqkgggiatehlit
lghsriafisgtaihdtaqrrkegyletlasaglrseaawvvdagweadagsaalntlyr
ganlgkpdgptavvvasvnaavgalstalrlglrvpedlsivginttwvsdtvypalttv
rlplqrlgevaadvlmehlggraltdtvvtqptpellvrettapp
Timeline for d3kkec_: