![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries) Uniprot P61086 157-198 |
![]() | Domain d3k9pa2: 3k9p A:157-199 [232703] Other proteins in same PDB: d3k9pa1, d3k9pb_ automated match to d1ylaa1 |
PDB Entry: 3k9p (more details), 2.8 Å
SCOPe Domain Sequences for d3k9pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k9pa2 a.5.2.1 (A:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vsspeytkkienlcamgfdrnavivalsskswdvetatellls
Timeline for d3k9pa2: