SCOPe 2.06: Domain d3k9oa2: 3k9o A:157-200

Lineage for d3k9oa2 (3k9o A:157-200)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140328] (7 PDB entries)
   Uniprot P61086 157-198

8. Domain d3k9oa2: 3k9o A:157-200 [232700]
   Other proteins in same PDB: d3k9oa1, d3k9ob_
   automated match to d1ylaa1

Details for d3k9oa2

PDB Entry: 3k9o, 1.8 Å

PDB Description: The crystal structure of E2-25K and UBB+1 complex

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d3k9oa2:

Sequence; same for both SEQRES and ATOM records:

>d3k9oa2 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatelllsn

Timeline for d3k9oa2:

• d3k9oa2 first appeared in SCOPe 2.03
  
• d3k9oa2 appears in SCOPe 2.05
  
• d3k9oa2 appears in SCOPe 2.07
  
• d3k9oa2 appears in the current release, SCOPe 2.08