SCOPe 2.06: Domain d3kdse2: 3kds E:403-603

Lineage for d3kdse2 (3kds E:403-603)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
   array of 6 helices and a 2-stranded beta-ribbon

4. Superfamily a.269.1: FtsH protease domain-like [140990] (1 family)
   contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
   automatically mapped to Pfam PF01434

5. Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
   Pfam PF01434; Peptidase family M41

6. Protein automated matches [232691] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [232692] (1 PDB entry)

8. Domain d3kdse2: 3kds E:403-603 [232698]
   Other proteins in same PDB: d3kdse1, d3kdsf1, d3kdsg1
   automated match to d2ce7a1
   complexed with nhx, zn

Details for d3kdse2

PDB Entry: 3kds, 2.6 Å

PDB Description: apo-ftsh crystal structure

PDB Compounds: (E:) cell division protein ftsh

SCOPe Domain Sequences for d3kdse2:

Sequence, based on SEQRES records:

>d3kdse2 a.269.1.1 (E:403-603) automated matches {Thermotoga maritima [TaxId: 2336]}
agparksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpee
dkylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelg
plawgkeeqevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldni
veilleketiegdelrrilse

Sequence, based on observed residues (ATOM records):

>d3kdse2 a.269.1.1 (E:403-603) automated matches {Thermotoga maritima [TaxId: 2336]}
agparksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpee
dkylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelg
plawgkrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketieg
delrrilse

Timeline for d3kdse2:

• d3kdse2 first appeared in SCOPe 2.03
  
• d3kdse2 appears in SCOPe 2.05
  
• d3kdse2 appears in SCOPe 2.07
  
• d3kdse2 appears in the current release, SCOPe 2.08