Lineage for d3kdse2 (3kds E:403-603)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1286999Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 1287000Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
    automatically mapped to Pfam PF01434
  5. 1287001Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
    Pfam PF01434; Peptidase family M41
  6. 1287019Protein automated matches [232691] (1 species)
    not a true protein
  7. 1287020Species Thermotoga maritima [TaxId:2336] [232692] (1 PDB entry)
  8. 1287021Domain d3kdse2: 3kds E:403-603 [232698]
    Other proteins in same PDB: d3kdse1, d3kdsf1, d3kdsg1
    automated match to d2ce7a1
    complexed with nhx, zn

Details for d3kdse2

PDB Entry: 3kds (more details), 2.6 Å

PDB Description: apo-ftsh crystal structure
PDB Compounds: (E:) cell division protein ftsh

SCOPe Domain Sequences for d3kdse2:

Sequence, based on SEQRES records: (download)

>d3kdse2 a.269.1.1 (E:403-603) automated matches {Thermotoga maritima [TaxId: 2336]}
agparksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpee
dkylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelg
plawgkeeqevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldni
veilleketiegdelrrilse

Sequence, based on observed residues (ATOM records): (download)

>d3kdse2 a.269.1.1 (E:403-603) automated matches {Thermotoga maritima [TaxId: 2336]}
agparksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpee
dkylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelg
plawgkrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketieg
delrrilse

SCOPe Domain Coordinates for d3kdse2:

Click to download the PDB-style file with coordinates for d3kdse2.
(The format of our PDB-style files is described here.)

Timeline for d3kdse2: