![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.269: FtsH protease domain-like [140989] (1 superfamily) array of 6 helices and a 2-stranded beta-ribbon |
![]() | Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) ![]() contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold automatically mapped to Pfam PF01434 |
![]() | Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins) Pfam PF01434; Peptidase family M41 |
![]() | Protein automated matches [232691] (1 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:2336] [232692] (1 PDB entry) |
![]() | Domain d3kdsf2: 3kds F:403-603 [232697] Other proteins in same PDB: d3kdse1, d3kdsf1, d3kdsg1 automated match to d2ce7a1 complexed with nhx, zn |
PDB Entry: 3kds (more details), 2.6 Å
SCOPe Domain Sequences for d3kdsf2:
Sequence, based on SEQRES records: (download)
>d3kdsf2 a.269.1.1 (F:403-603) automated matches {Thermotoga maritima [TaxId: 2336]} agparksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpee dkylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelg plawgkeeqevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldni veilleketiegdelrrilse
>d3kdsf2 a.269.1.1 (F:403-603) automated matches {Thermotoga maritima [TaxId: 2336]} agparksllispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpee dkylvsrnelldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelg plawgklrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleketiegd elrrilse
Timeline for d3kdsf2:
![]() Domains from other chains: (mouse over for more information) d3kdse1, d3kdse2, d3kdsg1, d3kdsg2 |