Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein AAA domain of cell division protein FtsH [82418] (3 species) ATP-dependent protease |
Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries) Uniprot Q9WZ49 150-402 |
Domain d3kdsg1: 3kds G:156-402 [232687] Other proteins in same PDB: d3kdse2, d3kdsf2, d3kdsg2 automated match to d2ce7a2 complexed with nhx, zn |
PDB Entry: 3kds (more details), 2.6 Å
SCOPe Domain Sequences for d3kdsg1:
Sequence, based on SEQRES records: (download)
>d3kdsg1 c.37.1.20 (G:156-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]} krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhrgaglgg ghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlg rkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfe eaidrvi
>d3kdsg1 c.37.1.20 (G:156-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]} krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhdereqtl nqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkileiht rnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrvi
Timeline for d3kdsg1:
View in 3D Domains from other chains: (mouse over for more information) d3kdse1, d3kdse2, d3kdsf1, d3kdsf2 |