SCOPe 2.05: Domain d3kdsf1: 3kds F:156-402

Lineage for d3kdsf1 (3kds F:156-402)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein AAA domain of cell division protein FtsH [82418] (3 species)
   ATP-dependent protease

7. Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries)
   Uniprot Q9WZ49 150-402

8. Domain d3kdsf1: 3kds F:156-402 [232686]
   Other proteins in same PDB: d3kdse2, d3kdsf2, d3kdsg2
   automated match to d2ce7a2
   complexed with nhx, zn

Details for d3kdsf1

PDB Entry: 3kds, 2.6 Å

PDB Description: apo-ftsh crystal structure

PDB Compounds: (F:) cell division protein ftsh

SCOPe Domain Sequences for d3kdsf1:

Sequence, based on SEQRES records:

>d3kdsf1 c.37.1.20 (F:156-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava
geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhrgaglgg
ghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlg
rkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfe
eaidrvi

Sequence, based on observed residues (ATOM records):

>d3kdsf1 c.37.1.20 (F:156-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
krvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgatllarava
geanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhdereqtl
nqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkileiht
rnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrvi

Timeline for d3kdsf1:

• d3kdsf1 first appeared in SCOPe 2.03
  
• d3kdsf1 appears in SCOPe 2.04
  
• d3kdsf1 appears in SCOPe 2.06
  
• d3kdsf1 appears in the current release, SCOPe 2.08