| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
| Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
| Protein automated matches [190117] (50 species) not a true protein |
| Species Chlorobaculum tepidum [TaxId:1097] [232683] (1 PDB entry) |
| Domain d3kd6b_: 3kd6 B: [232685] Other proteins in same PDB: d3kd6a2 automated match to d3b1rb_ complexed with amp, gol |
PDB Entry: 3kd6 (more details), 1.88 Å
SCOPe Domain Sequences for d3kd6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kd6b_ c.72.1.0 (B:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
sllvigslafddietpfgrsdntlggsstyialsasyftdepirmvgvvgsdfgkehfdl
lhaknidtrgiqviedgktfrwagryhydmntrdtldtqlnvfaefdphvpqyyrdskfv
clgnidpelqlkvldqiddpklvvcdtmnfwiegkpeelkkvlarvdvfivndsearlls
gdpnlvktariiremgpktliikkgehgallftdngifaapafplesiydptgagdtfag
gfighlarcgntseaemrkavlygsamasfcveqfgpyryndldllevddryqsflel
Timeline for d3kd6b_: