SCOPe 2.03: Domain d3kafa1: 3kaf A:7-37

Lineage for d3kafa1 (3kaf A:7-37)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.0: automated matches [227264] (1 protein)
   not a true family

6. Protein automated matches [227055] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226058] (4 PDB entries)

8. Domain d3kafa1: 3kaf A:7-37 [232682]
   Other proteins in same PDB: d3kafa2
   automated match to d2xp6a1

Details for d3kafa1

PDB Entry: 3kaf, 2.3 Å

PDB Description: structure-guided design of alpha-amino acid-derived pin1 inhibitors

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3kafa1:

Sequence; same for both SEQRES and ATOM records:

>d3kafa1 b.72.1.0 (A:7-37) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppgwekamsrssgrvyyfnhitnasqwerp

Timeline for d3kafa1:

• d3kafa1 is new in SCOPe 2.03-stable
  
• d3kafa1 appears in SCOPe 2.04
  
• d3kafa1 appears in the current release, SCOPe 2.08